PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016489981.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 277aa    MW: 31409.4 Da    PI: 8.4034
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016489981.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-18118172256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tkeq  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  XP_016489981.1 118 RKKLRLTKEQSSVLEENFKEHSTLNPKQKLALAKRLGLRARQVEVWFQNRRARTK 172
                     678899***********************************************98 PP

2HD-ZIP_I/II122.62e-39118207191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rl+keq+++LEe+F+e+++L+p++K +la++Lgl++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  XP_016489981.1 118 RKKLRLTKEQSSVLEENFKEHSTLNPKQKLALAKRLGLRARQVEVWFQNRRARTKLKQTEVDCEFLKRCVENLTEENRRLQKEVQELR-AL 207
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046184.2E-27292IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.604.1E-1792171IPR009057Homeodomain-like
SuperFamilySSF466895.01E-18107175IPR009057Homeodomain-like
PROSITE profilePS5007117.2114174IPR001356Homeobox domain
SMARTSM003896.5E-15116178IPR001356Homeobox domain
PfamPF000464.3E-16118172IPR001356Homeobox domain
CDDcd000866.88E-14118175No hitNo description
PRINTSPR000313.4E-5145154IPR000047Helix-turn-helix motif
PROSITE patternPS000270149172IPR017970Homeobox, conserved site
PRINTSPR000313.4E-5154170IPR000047Helix-turn-helix motif
Gene3DG3DSA:1.20.5.1707.2E-4172206No hitNo description
SMARTSM003401.8E-26174217IPR003106Leucine zipper, homeobox-associated
PfamPF021834.1E-10174208IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MEDLGLSLSL SFPENRTVTP AHLNLIRKTS WTHSFPSSDR NSETCRVETR TFLKGIDVNR  60
LPATADTEEE AGVSSPNSTI SSVSGNKRNE REANCEEHDM ERACSRGISD EEDGENCRKK  120
LRLTKEQSSV LEENFKEHST LNPKQKLALA KRLGLRARQV EVWFQNRRAR TKLKQTEVDC  180
EFLKRCVENL TEENRRLQKE VQELRALKLS PQFYMQMTPP TTLTMCPSCE RVASGPTSTP  240
GNLRLGPPQQ LNLWATTPIS QGQSGQMDSY PTLARQK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1166174RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755189e-68HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788263.10.0PREDICTED: homeobox-leucine zipper protein HAT4-like
RefseqXP_016489981.10.0PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054661e-101HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLK4C6R31e-143K4C6R3_SOLLC; Uncharacterized protein
STRINGSolyc06g060830.2.11e-143(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.17e-90homeobox protein 2